Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

796 – 810 of 129,988 results

796

Invitrogen™ Human CAMKK2 (CaMKK Beta), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	CAMKK2
Molecular Weight (g/mol)	87.1 kDa
KinaseFamily	CAMKK Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human CAMKK2 (CaMKK Beta), GST Tag
Accession Number	Q96RR4
Gene Alias	6330570N16Rik; AW061083; Ca+/Calmodulin-dependent protein kinase kinase beta (CaM-kinase kinase beta); calcium/calmodulin dependent protein kinase kinase 2; calcium/calmodulin-dependent protein kinase 2 beta; calcium/calmodulin-dependent protein kinase beta; calcium/calmodulin-dependent protein kinase kinase 2; calcium/calmodulin-dependent protein kinase kinase 2, beta; calcium/calmodulin-dependent protein kinase kinase beta; caM-kinase kinase 2; CaM-kinase kinase beta; CAMKK; caMKK 2; caM-KK 2; caMKK beta; CaM-KK beta; CAMKK beta protein; CAMKK2; CAMKKB; KIAA0787; MGC15254; mKIAA0787
Gene ID (Entrez)	10645
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

797

Invitrogen™ Human CF106 (aa 80-151) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	DVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSR
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human CF106 (aa 80-151) Control Fragment
Recombinant	Recombinant

798

Invitrogen™ Human FYN, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	Fyn
Molecular Weight (g/mol)	62.7 kDa
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human FYN, His Tag
Accession Number	P06241
Gene Alias	AI448320; AW552119; C syn protooncogene; c-syn protooncogene; EC 2.7.10.2; Fyn; fyn {ECO:0000312; FYN oncogene related to SRC, FGR, YES; Fyn proto-oncogene; FYN proto-oncogene, Src family tyrosine kinase; kinase Fyn; MGC45350; OKT3-induced calcium influx regulator; OTTHUMP00000017916; OTTHUMP00000017917; P59 p59-Fyn; p59-Fyn; Proto-oncogene c-Fyn; Protooncogene Syn; proto-oncogene Syn; proto-oncogene tyrosine-protein kinase Fyn; RGD:2641}; RP1-66H14.1; SLK; Src Kinase p59; Src like kinase; src/yes-related novel; src-like kinase; SYN; tyrosine kinase p59fyn(T); tyrosine-protein kinase Fyn
Product Type	FYN Recombinant Human Protein
Gene ID (Entrez)	2534
Formulation	20 mM tris with 0.05% NP-40, 0.05 mM EDTA, 100 mM NaCl, 1 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

799

Invitrogen™ Human CDK16 (PCTK1)/cyclin Y, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	PCTAIRE1
Molecular Weight (g/mol)	71.1-65.5 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human CDK16 (PCTK1)/cyclin Y, GST Tag
Accession Number	Q00536
Gene Alias	Cdk16; cdk16.L; cdk16.S; Cell division protein kinase 16; Crk5; cyclin dependent kinase 16; cyclin-dependent kinase 16; cyclin-dependent kinase 16 L homeolog; cyclin-dependent kinase 16 S homeolog; FLJ16665; PCTAIRE; PCTAIRE protein kinase 1; PCTAIRE1; PCTAIRE-1 protein kinase, alternatively spliced; PCTAIRE-motif protein kinase 1; pctgaire; pctk1; PCTK1 protein; Serine/threonine-protein kinase PCTAIRE-1; testis secretory sperm-binding protein Li 224 n
Protein Length	108-end; 2-end
Gene ID (Entrez)	5127
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

800

Invitrogen™ Human CSNK1E (CK1 ε), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	52.3 kDa
Formulation	50 mM tris HCl with 0.04% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 4 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human CSNK1E (CK1 ε), His Tag
Recombinant	Recombinant

801

Invitrogen™ Human EphA2, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	76.7 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human EphA2, GST Tag
Recombinant	Recombinant

802

Invitrogen™ Human FYN A, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	87.1 kDa
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human FYN A, GST Tag
Recombinant	Recombinant

803

Invitrogen™ Human RIPK5, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	132.7 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human RIPK5, GST Tag
Recombinant	Recombinant

804

Invitrogen™ Human LXR-a, Ligand Binding Domain, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Formulation	proprietary buffer with no preservative
Concentration	See Label
For Use With (Application)	Ligand Binding Assay
Name	Human LXR-a, Ligand Binding Domain, GST Tag
Recombinant	Recombinant

805

Invitrogen™ Human PRKCN (PKD3), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Purity or Quality Grade	95% by SDS-PAGE
Conjugate	Unconjugated
Form	Liquid
Common Name	PRKD3
Molecular Weight (g/mol)	127.9 kDa
KinaseFamily	PKN
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human PRKCN (PKD3), GST Tag
Accession Number	O94806
Gene Alias	4930557O20Rik; 5730497N19Rik; EPK2; nPKC-D1; nPKC-mu; nPKC-nu; PKCM; PKC-MU; Pkcnu; PKC-NU; PKD; PKD1; PKD3; PRKCM; Prkcn; PRKD1; Prkd3; Protein kinase C mu type; protein kinase C nu type; protein kinase C, mu; protein kinase C, nu; protein kinase D; protein kinase D1; protein kinase D3; protein kinase EPK2; Serine/threonine-protein kinase D1; serine/threonine-protein kinase D3
Product Type	PRKCN (PKD3) Recombinant Human Protein
Gene ID (Entrez)	23683
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

806

Invitrogen™ Human ROCK2, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	ROCK2
Molecular Weight (g/mol)	90.8 kDa
KinaseFamily	DMPK Kinase Family
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human ROCK2, GST Tag
Accession Number	O75116
Gene Alias	B230113H15Rik; KIAA0619; mKIAA0619; p150 ROK-alpha; p164 ROCK-2; Rho associated coiled-coil containing protein kinase 2; Rho kinase 2; RhoA - binding serine/threosine kinase alpha (ROK - alpha); rhoA-binding kinase 2; Rho-associated coiled-coil containing protein kinase 2; Rho-associated coiled-coil forming kinage 2; Rho-associated coiled-coil forming kinase 2; rho-associated protein kinase 2; Rho-associated, coiled-coil-containing protein kinase 2; rho-associated, coiled-coil-containing protein kinase II; Rho-kinase; ROCK II; Rock2; Rock2m; rockii; ROCK-II; ROK; ROKalpha
Protein Length	1-552
Gene ID (Entrez)	9475
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

807

Invitrogen™ Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	97.9 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag
Recombinant	Recombinant

808

Invitrogen™ Human MAP4K5 (KHS1), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	122.5 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human MAP4K5 (KHS1), GST Tag
Recombinant	Recombinant

809

Invitrogen™ Human MYO3B (MYO3 beta), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	MYO3B
Molecular Weight (g/mol)	63.3 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human MYO3B (MYO3 beta), GST Tag
Accession Number	Q8WXR4
Gene Alias	A430065P19Rik; MYO3B; myosin IIIB; myosin IIIB1; myosin IIIB2; myosin-IIIb; RGD1560313
Protein Length	1-362
Gene ID (Entrez)	140469
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM EGTA, 0.1 mM PMSF, 0.25 mM DTT, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

810

Invitrogen™ Human ACVR2A, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	ACVR2A
Molecular Weight (g/mol)	85.3 kDa
KinaseFamily	STKR Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human ACVR2A, GST Tag
Accession Number	P27037
Gene Alias	activin A receptor type 2 A; activin A receptor type IIA; activin A receptor, type IIA; activin receptor IIA; activin receptor type IIA; Activin receptor type-2 A; Actrii; ActrIIa; ACTR-IIA; ACVR2; Acvr2a; rActR-II; TactrII; type II activin receptor
Gene ID (Entrez)	92
Formulation	50 mM tris HCl with 0.02% NP-40, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

Prev
1
...
52
53
54
55
...
8,666
Next

Recombinant Proteins

Filtered Search Results

Narrow Results